#victorybeautycare

Posts Share

beautykey.skin. Mau makin cantik terawat?? Atasi masalah dgn produk yg tidak malah bik

Mau makin cantik terawat?? Atasi masalah dgn produk yg tidak malah bikin masalah?? Apaan itu?? VBC bisa jd jawaban kamyuuu Buruan deh.. Yuks mari dimari saya kasih solusinya belinya disini Distributor resmi pusatnya vbc: Info konsul order: Line: cece_key Wa: 081217175822 Bbm: D1723236 Melayani cust/resel/agen Pembelian ecer/paket/grosir Banyak promo/bonus/berhadiah #real_keyshop #distributorvbc #distributorvbeautycare #vbeautycare #v #victorybeautycare #bestproduk #vbeautycaremalang #bpom #skincarebpom #perawatankulit #perawatanbadan #perawatanwajah #kulitputih #kulitsehat #bebasjerawat #bebaskomedo #obatjerawat #bebasflek #recomended #recomendedolshop #recomendedseller

Share 109 0
hauracantiq. Testi2 #victorybeautycare

Testi2 #victorybeautycare

Share 3 0
beautykey.skin. BEAUTY SECRET LASH SERUM (10ML) - FREE SIKAT MASCARA -

IDR 175.000

K

BEAUTY SECRET LASH SERUM (10ML) - FREE SIKAT MASCARA - IDR 175.000 Kegunaan: Untuk memanjangkan dan menebalkan bulu mata serta alis dalam waktu pemakaian satu minggu. Tergantung pada siklus pertumbuhan masing-masing orang. BISA DIGUNAKAN SEBAGAI SERUM SAAT KONDISI EYELASH EXTENTION Cara pemakaian: Kocok serum terlebih dahulu, tuang satu tetes serum ke sikat lalu oleskan pada alis terlebih dahulu kemudian bulu mata. (BISA SALAH SATU SAJA). Serum dapat digunakan pada siang hari dan malam hari. Tidak disarankan digunakan pada saat bepergian . . Ordernya disini👇👇👇 Wa: 081217175822 Line: cece_key Bbm: D1723236 #serum #serumbulumata #serumalis #vbeautycare #victorybeautycare #recomended #recomendedolshopindonesia

Share 58 0
beautykey.skin. Pasti tau kan gimana susahnya kempesin dan hilangkan jerawat batu,,,jg

Pasti tau kan gimana susahnya kempesin dan hilangkan jerawat batu,,,jgn sepelekan proses klu kamu pingin terbantu yaaa Atasi dan hempas jerawatmu dgn paket acne vbc Telaten rajin sabar nikmati perawatannya ya dears. Proses pst ada hasil yaa Kapan giliran kamu?? Belinya disini yaaa Distributor resmi pusatnya vbc: Info konsul order: Line: cece_key Wa: 081217175822 Bbm: D1723236 Melayani cust/resel/agen Pembelian ecer/paket/grosir Banyak promo/bonus/berhadiah #real_keyshop #distributorvbc #distributorvbeautycare #vbeautycare #distributorskincare #victorybeautycare #bestproduk #vbeautycaremalang #bpom #skincarebpom #perawatankulit #perawatanbadan #perawatanwajah #kulitputih #kulitsehat #bebasjerawat #bebaskomedo #obatjerawat #bebasflek #recomended #recomendedolshop #recomendedseller

Share 111 0
beautykey.skin. Flek?? Huzzz sana 😄
Kusam kucel?? Wuzzzz 😍
Cantik mulus? Ohh yessss

Flek?? Huzzz sana 😄 Kusam kucel?? Wuzzzz 😍 Cantik mulus? Ohh yessss 😘 Sehat segarrr? Uyeeeee 💃 Intinya telaten, rajin, sabar,nikmati perawatannya ya dears Ikhtiar dan Proses pasti ada hasil Bahan kualitas terbaik Bpom No mercury Halal Ringan nyaman aman Ordernya disini👇👇👇 www.vbeautycareoriginal.com www.keyvictorybeautycare.com . . Belinya disini Distributor resmi pusatnya vbc: Info konsul order: Line: cece_key Wa: 081217175822 Bbm: D1723236 Melayani cust/resel/agen Pembelian ecer/paket/grosir Banyak promo/bonus/berhadiah #distributorvbc #distributorvbeautycare #vbeautycare #v #victorybeautycare #bestproduk #vbeautycaremalang #bpom #skincarebpom #perawatankulit #perawatanbadan #perawatanwajah #kulitputih #kulitsehat #bebasjerawat #bebaskomedo #obatjerawat #bebasflek #recomended #recomendedolshop #recomendedseller

Share 116 1
beautykey.skin. Liattt sayyy... Hasil paket high premium yg best seller \"belum di pole

Liattt sayyy... Hasil paket high premium yg best seller "belum di poles day cream": kulit lebih licin glowing 😍 jerawat bks jrwt dihempas pasti 😘 Perbaiki Warna kulit tidak rata👍 . . DAPATKAN SOLUSI TERBAIK DGN VBC . . Yuks mari saya kasih solusinya Distributor resmi pusatnya vbc: Info konsul order: Line: cece_key Wa: 081217175822 Bbm: D1723236 Melayani cust/resel/agen Pembelian ecer/paket/grosir Banyak promo/bonus/berhadiah #real_keyshop #distributorvbc #distributorvbeautycare #vbeautycare #v #victorybeautycare #bestproduk #vbeautycaremalang #bpom #skincarebpom #perawatankulit #perawatanbadan #perawatanwajah #kulitputih #kulitsehat #bebasjerawat #bebaskomedo #obatjerawat #bebasflek #recomended #recomendedolshop #recomendedseller

Share 113 0
hauracantiq. Paket basic luxury :
✓basic facial wash ✓basic cleanser
✓toner luxury

Paket basic luxury : ✓basic facial wash ✓basic cleanser ✓toner luxury ✓basic day/fondi cream ✓basic night cream ✓✓free serum beauty c&e • • • #victorybeautycare #vbeautycaremalang #vbeautycareoriginal #v #vbclovers #vbctestimonials #vbeautycare #skincareaman #skincarejatimbpom #skincaremalang #skincare #perawatanwajah #kulitsehat #kulitputih #hauracantiq

Share 4 0

Real....perawatan di KUSUMA SALON Konsultasi bisa DM,coment atau hub nomer 081311618194 #kusumasalon #kusumabeautycare #victorybeautycare #saloncantik

Share 24 9
hauracantiq. Paket basic luxury dengan whitening night plus cream 
Dengan toner yg

Paket basic luxury dengan whitening night plus cream Dengan toner yg baru -->> toner luxury wajah halus putih lebih sempurna Terdiri dari ✓basic day/fondi cream ✓whitening plus night cream ✓basic facial wash ✓toner luxury ✓basic cleanser ✓✓free serum beauty c e • • Wa : 085257587071 • • #victorybeautycare #vbeautycaremalang #vbeautycareoriginal #v #vbclovers #vbctestimonials #vbeautycare #skincareaman #skincarejatimbpom #skincaremalang #skincare #perawatanwajah #kulitsehat #kulitputih #hauracantiq #toner

Share 2 0
hauracantiq. Paket basic luxury :
✓basic facial wash ✓basic cleanser
✓toner luxury

Paket basic luxury : ✓basic facial wash ✓basic cleanser ✓toner luxury ✓basic day/fondi cream ✓basic night cream ✓✓free serum beauty c&e • • • #victorybeautycare #vbeautycaremalang #vbeautycareoriginal #v #vbclovers #vbctestimonials #vbeautycare #skincareaman #skincarejatimbpom #skincaremalang #skincare #perawatanwajah #kulitsehat #kulitputih #hauracantiq

Share 4 0
hauracantiq. Paket basic luxury :
✓basic facial wash ✓basic cleanser
✓toner luxury

Paket basic luxury : ✓basic facial wash ✓basic cleanser ✓toner luxury ✓basic day/fondi cream ✓basic night cream ✓✓free serum beauty c&e • • • #victorybeautycare #vbeautycaremalang #vbeautycareoriginal #v #vbclovers #vbctestimonials #vbeautycare #skincareaman #skincarejatimbpom #skincaremalang #skincare #perawatanwajah #kulitsehat #kulitputih #hauracantiq

Share 1 0
keyshop_beautycare. PAKET HIGH PREMIUM WHITENING \"
Paket ini bisa digunakan utk semua jeni

PAKET HIGH PREMIUM WHITENING " Paket ini bisa digunakan utk semua jenis kulit dan masalah2 tsb dibawah ini : - Flek - Acne - Bekas Jerawat - Kebal Pemutih - Membantu Break Out Produk2 Skincare Gajebo - Kulit Tidak Merata - Bopeng / Scar TERDIRI DARI : 1. Whitening High Night Cream 2. High Facial Wash 60ml 3. Purify Tretin High Peeling 20ml 4. Whitening High Liquid Fondation 20 ml 5. High Cleanser 100 ml 6. Serum Beauty Lifting 10 ml Paket ini bermanfaat utk : 1. bleaching 2. whitening 3. remove flek & dark spot 4. meregenerasi sel kulit 5. memutihkan kulit 6. membunuh jerawat 7. mengecilkan pori2 8. membantu mengangkat volume bopeng. Tidak dapat di gunakan oleh wanita hamil dan menyusui (baby usia kurang dari 6bulan) (S&K BERLAKU) IDR 585.000 . . Info konsul order: Wa: 081217175822 Line: cece_key Shopee.co.id/vbeautycareoriginalpusat #distributorskincarebpom #skincare #perawatankulit #perawatanwajah #paketperawatanwajah #paketpemutihwajah #putihglowing #creamwajah #vbeautycare #victorybeautycare #recomended #bestseller

Share 3 0
keyshop_beautycare. Facial Wash by vbc NON COMEDOGENIC dan tidak membuat kulit berjerawat.

Facial Wash by vbc NON COMEDOGENIC dan tidak membuat kulit berjerawat. mengandung bahan-bahan alami,herbal aha, vitamin c&e yg aman dan terbukti dapat mencerahkan kulit, mengontrol minyak tapi tidak mengurangi kelembaban kulit dgn PH (5,5) seimbang yg dibutuhkan kulit. membersihkan kulit lbh optimal, mengangkat sisa kotoran/noda/makeup yang nempel, mengencangkan kulit, mengangkat kulit mati, meremajakan kulit, menghaluskan melembutkan kulit. Dapatkan kulit lbh bersih,seger,cerah,kenyal,glow. . . Diamond facial wash 100ml IDR ONLY Rp. 90.000,- . . Info konsul order: Wa: 081217175822 Line: cece_key shopee.co.id/vbeautycareoriginalpusat #vbeautycare #victorybeautycare #pembersihwajah #sabunwajah #skincarebpom #perawatankulit #perawatanwajah #distributorskincarebpom

Share 6 0
trivagrosir_official. Bunda bermasalah dengan bekas jerawat?

Bekas jerawat sudah pasti sang

Bunda bermasalah dengan bekas jerawat? Bekas jerawat sudah pasti sangat mengganggu ya bunda, selain mengganggu kepercayaan diri bekas jerawat juga bisa membuat wajah bunda terlihat lebih tua dan tidak terawat. Gunakan TRIVA Skincare untuk menghilangkan bekas jerawat dan menambah kecerahan, kelembapan, serta kekencangan kulit wajah bunda 😉 . . #trivaskincare #trivaskincarepemutihwajah #trivaskincarepenghilangflekhitam #trivaskincarepenghilangkeriput #trivaskincarewajahglowing #beautycareshoparmenia #vslbeautycarelovers #beautycarealami #beautycares #beautycaremalaysia #beautycaremakassar #glansiebeautycare #victorybeautycare #beautycaresolo #beautycarehalal #naturerepublicpalembang #naturerepublicaloe #naturerepublicmask #naturerepublicsoothinggel #naturerepublicpku

Share 0 0
trivaskincare_official. Apa masalah kulit wajah bunda?

Kulit wajah kusam, berjerawat, keriput

Apa masalah kulit wajah bunda? Kulit wajah kusam, berjerawat, keriput, flek hitam dan lainnya bisa diatasi dengan TRIVA Skincare. Gunakan secara rutin rangkaian perawatan TRIVA Skincare dan gunakan Serum Vitamin C untuk meregenerasi sel kulit mati bunda, wajah makin cerah bersinar 😍 Tuliskan masalah kulit wajah bunda pada kolom komentar 😉 . . #trivaskincare #trivaskincarepemutihwajah #trivaskincarepenghilangflekhitam #trivaskincarepenghilangkeriput #trivaskincarewajahglowing #beautycareshoparmenia #vslbeautycarelovers #beautycarealami #beautycares #beautycaremalaysia #beautycaremakassar #glansiebeautycare #victorybeautycare #beautycaresolo #beautycarehalal #naturerepublicpalembang #naturerepublicaloe #naturerepublicmask #naturerepublicsoothinggel #naturerepublicpku

Share 9 0
hauracantiq. Whitening High Night Cream 10gram

Kegunaan : bleaching, whitening, re

Whitening High Night Cream 10gram Kegunaan : bleaching, whitening, remove flek, anti acne, peeling cream, scar cream. . . Note : Di pakai saat tertentu bukan sebagai treatment jangka panjang (dlm artian sudah pakai 2 pot setelahnya pakai jarang2 saja bs 1-2x dlm seminggu,, selebihnya bisa diselingi serum/crram mlm basic/diamond). Sangat bantu atasi bekas jerawat sulit hilang, kulit tidak merata, kulit kusam, jerawat, flek. Tidak dapat di gunakan oleh wanita hamil dan menyusui . . #real_keyshop #distributorvbc #distributorvbeautycare #vbeautycare #v #victorybeautycare #bestproduk #vbeautycaremalang #bpom #skincarebpom #perawatankulit #perawatanbadan #perawatanwajah #kulitputih #kulitsehat #bebasjerawat #bebaskomedo #obatjerawat #bebasflek #recomended #recomendedolshop #recomendedseller

Share 5 0
keyshop_beautycare. SPESIAL FOR YOU
*HANYA HARI INI* 26/12/18 CLOSE 00.00 WIB * Setiap pem

SPESIAL FOR YOU *HANYA HARI INI* 26/12/18 CLOSE 00.00 WIB * Setiap pembelian Ecer / Satuan Senilai *harga antara Rp. 300.000 s.d Rp. 400.000* dapat PRODUCT berupa *DIAMOND FONDI DAY CREAM* * Setiap pembelian Ecer / Satuan Senilai *harga diatas Rp. 400.000* dapat PRODUCT berupa *SERUM BEAUTY WHITE NETT 20 ML* * Setiap Pembelian 1 Paket Wajah / Badan KOMPLIT dapat *DISKON SEBESAR 10%* * *KHUSUS PEMBELIAN PRODUCT ECER / SATUAN* Berlaku juga pembelian di shopee * *KHUSUS PEMBELIAN PAKET WAJAH / BADAN KOMPLIT* TIDAK Berlaku pada pembelian di shopee,. HARUS TRANSFER LANGSUNG. * Berlaku kelipatan * Tidak ada Subsidi ongkir Note: Promo kami berbeda2 yaah. Jd jika memang di Rasa tertarik,. Silahkan segera Order.. Dan ini adalah Manfaat Produk tsb adalah sbb: *MANFAAT DIAMOND FONDI DAY CREAM:* 1. Menjaga tingkat kelembaban kulit secara optimal di sepanjang hari 2. Mencegah dehidrasi yang bisa menyebabkan penuaan dini dan melindungi kulit dari RADIASI UV krn ber-SPF 50. 3. Sebagai oil control yang membuat makeup Anda tetap melekat sempurna. 4. Menghidrasi lembut untuk kulit kering. 5. Mengandung Ekstrak Kedelai & Ekstrak Cengkeh Merah untuk mendukung produksi kolagen alami. 6. Diformulasi dengan Ekstrak Narcissus Tazetta Bulb untuk menstimulasi tingkat metabolisme alami kulit. 7. Mengurangi penampilan dari pori sementara melawan tanda dari penuaan prematur. 8. Mengandung Trehalose, Sodium Hyaluronate, Sodium PCA & Glycerin untuk hidrasi tahan lama. 8. Kulit lebih kencang, lembut, halus, cerah & lebih muda. *MANFAAT SERUM BEAUTY WHITE:* 1.Anti oksidan. 2.Anti aging. 3.Membantu pergantian sel kulit mati. 4.Mencerahkan kulit. 5.Menyamarkan flek/bekas jerawat. 6.Menormalkan kadar minyak. 7.Mengecilkan pori-pori. Terima Kasih Happy Shopping.. 💋💋 . . ORDER: WA: 081217175822 LINE: cece_key #promo #hadiah #giveaway #vbeautycare #vbc #victorybeautycare #recomended #skincarebpom #creamwajahaman #perawatanwajah #paketwajah #kulitputih #glowing

Share 11 0
beautykey.skin. HEBOOOOOHHHHHHHH
KHUSUS Hari ini ya.. 21 Desember 2018 *PROGRAM PROMO

HEBOOOOOHHHHHHHH KHUSUS Hari ini ya.. 21 Desember 2018 *PROGRAM PROMO FLASH SALE SPESIAL* Syarat & Ketentuan : 1. Setiap pembelian Ecer / Satuan Senilai *harga kurang dari Rp. 400.000* dapat *DISKON 5%* 2. Setiap pembelian Ecer / Satuan Senilai *harga diatas Rp. 400.000* dapat *DISKON 10%* 3. Setiap Pembelian 1 Paket Wajah / Badan KOMPLIT dapat sepasang (2) Product yaitu *WHITENING MICELLAR WATER NETT 100 ML* dan *HIGH FACIAL WASH NETT 60 ML* 4. *KHUSUS PEMBELIAN PAKET KOMPLIT* Berlaku juga pembelian via aplikasi market,. Namun tidak berlaku untuk Promo Diskon Aplikasi Market. 5. Berlaku kelipatan 6. Tidak ada Subsidi ongkir 7. Promo berakhir Hari ini,. Jam 00.00 Note: Promo kami berbeda2 yaah. Jd jika memang di Rasa tertarik,. Silahkan segera Order.. Dan ini adalah Manfaat Produk tsb adalah sbb: *MANFAAT WHITENING MICELLAR WATER:* 1. All-in-One Whitening Micellar Water, diperkaya dengan Smart Micelles, dapat mengikat dan mengangkat debu, kotoran, juga make-up dari wajah, mata, dan bibir. 2. Teksturnya ringan seperti air, sehingga dapat menghilangkan kotoran dan make-up dari wajah secara lembut tanpa perlu dibilas. 3. Formulanya tidak lengket di wajah, tidak berminyak, dan tanpa parfum. Cocok untuk semua jenis kulit termasuk kulit sensitif. *MANFAAT HIGH FACIAL WASH:* 1. Membersihkan Wajah & Membantu Regenerasi Kulit 2. Sabun high bukan papaya namun mengandung enzim papain dan serat papain. 3. tipikal sabun yg membantu regenerasi efek dari AHA dan kojicnya. 4. Sabun ini bisa utk kulit berjerawat karena kuat anti acne nya. Terima Kasih Happy Shopping.. 💋💋 . . order: Wa: 081217175822 Line: cece_key Shopee.co.id/vbeautycareoriginalpusat #promo #giveaway #hadiah #flashsale #vbeautycare #vbc #victorybeautycare #kulitputih #glowing #creamwajahbpom #skincarebpom #recomended #recomendedolshop

Share 7 0
keyshop_beautycare. HEBOOOOOHHHHHHHH
KHUSUS Hari ini ya.. 21 Desember 2018 *PROGRAM PROMO

HEBOOOOOHHHHHHHH KHUSUS Hari ini ya.. 21 Desember 2018 *PROGRAM PROMO FLASH SALE SPESIAL* Syarat & Ketentuan : 1. Setiap pembelian Ecer / Satuan Senilai *harga kurang dari Rp. 400.000* dapat *DISKON 5%* 2. Setiap pembelian Ecer / Satuan Senilai *harga diatas Rp. 400.000* dapat *DISKON 10%* 3. Setiap Pembelian 1 Paket Wajah / Badan KOMPLIT dapat sepasang (2) Product yaitu *WHITENING MICELLAR WATER NETT 100 ML* dan *HIGH FACIAL WASH NETT 60 ML* 4. *KHUSUS PEMBELIAN PAKET KOMPLIT* Berlaku juga pembelian via aplikasi market,. Namun tidak berlaku untuk Promo Diskon Aplikasi Market. 5. Berlaku kelipatan 6. Tidak ada Subsidi ongkir 7. Promo berakhir Hari ini,. Jam 00.00 Note: Promo kami berbeda2 yaah. Jd jika memang di Rasa tertarik,. Silahkan segera Order.. Dan ini adalah Manfaat Produk tsb adalah sbb: *MANFAAT WHITENING MICELLAR WATER:* 1. All-in-One Whitening Micellar Water, diperkaya dengan Smart Micelles, dapat mengikat dan mengangkat debu, kotoran, juga make-up dari wajah, mata, dan bibir. 2. Teksturnya ringan seperti air, sehingga dapat menghilangkan kotoran dan make-up dari wajah secara lembut tanpa perlu dibilas. 3. Formulanya tidak lengket di wajah, tidak berminyak, dan tanpa parfum. Cocok untuk semua jenis kulit termasuk kulit sensitif. *MANFAAT HIGH FACIAL WASH:* 1. Membersihkan Wajah & Membantu Regenerasi Kulit 2. Sabun high bukan papaya namun mengandung enzim papain dan serat papain. 3. tipikal sabun yg membantu regenerasi efek dari AHA dan kojicnya. 4. Sabun ini bisa utk kulit berjerawat karena kuat anti acne nya. Terima Kasih Happy Shopping.. 💋💋 . . order: Wa: 081217175822 Line: cece_key Shopee.co.id/vbeautycareoriginalpusat #promo #giveaway #hadiah #flashsale #vbeautycare #vbc #victorybeautycare #kulitputih #glowing #creamwajahbpom #skincarebpom #recomended #recomendedolshop

Share 3 0

So even though the skin on my face and scalp is suuuper oily all year round, I also suffer from #winter dryness on my arms and legs! Because that is why we can't have nice things! 😅 So I've had these #dryskin issues for a few years, and have tried a lot of lotions and creams that were just... Okay. Then I tried a trial of this Lubriderm Advanced Therapy Lotion from my dermatologist and it's done wonders for my (non face!) skin. Out of all these fancy lotions I've tried and so far this drug store brand has been the best at keeping the winter skin at bay! What is your go to #moisturizer for the winter? . . . #beautyblog #skincaremurah #naturalskincare #beauty #skincare #beautycareoriginal #victorybeautycare #beautyful #skincareroutine #lotionmurah #skincareaman #beautycare #lotion #skincaretips #skincarereview #oilyskincare #30plusskincare #putsthelotionontheskin

Share 67 4
beautykey.skin. HANYA HARI INI
FLASH TIME for DISKON

Syarat & Ketentuan: 
1. Hnya ber

HANYA HARI INI FLASH TIME for DISKON Syarat & Ketentuan: 1. Hnya berlaku Hari ini saja, 7 desember 2018. 2. Berlaku selama 24 Jam,. Close order jam 00.00 3. Untuk Paket Wajah / Badan diskon 10% (tidak termasuk paket hemat) 3. Untuk Satuan diskon 5% 4. Tidak ada batas minimal order 5. Tidak ada Subsidi / gratis ongkir 6. Hanya berlaku transfer penjual langsung (tidak melalui market place / aplikasi toko) 7. Stok terbatas, siapa cepat dia dapat. 8. Tidak ada nego wktu. (Di luar wktu yg di tentukan) Yups.. segera order aja ya dear... Terima kasih . . Ordernya disini: Wa: 081217175822 Line: cece_key #promo #flashsale #vbeautycare #victorybeautycare #vbc #distributorpusat #pusatskincarebpom #recomendedolshop

Share 3 0
keyshop_beautycare. HANYA HARI INI
FLASH TIME for DISKON

Syarat & Ketentuan: 
1. Hnya ber

HANYA HARI INI FLASH TIME for DISKON Syarat & Ketentuan: 1. Hnya berlaku Hari ini saja, 14 desember 2018. 2. Berlaku selama 24 Jam,. Close order jam 00.00 3. Untuk Paket Wajah / Badan diskon 10% (tidak termasuk paket hemat) 3. Untuk Satuan diskon 5% 4. Tidak ada batas minimal order 5. Tidak ada Subsidi / gratis ongkir 6. Hanya berlaku transfer penjual langsung (tidak melalui market place / aplikasi toko) 7. Stok terbatas, siapa cepat dia dapat. 8. Tidak ada nego wktu. (Di luar wktu yg di tentukan) Yups.. segera order aja ya dear... Terima kasih . . Ordernya disini: Wa: 081217175822 Line: cece_key #promo #flashsale #vbeautycare #victorybeautycare #vbc #distributorpusat #pusatskincarebpom #recomendedolshop

Share 6 0
beautykey.skin. *GRATIS \"KHUSUS HARI INI* 11/12/18 CLOSE 00.00 WIB

1. Setiap pembelia

*GRATIS "KHUSUS HARI INI* 11/12/18 CLOSE 00.00 WIB 1. Setiap pembelian Ecer / Satuan Senilai Rp. 300.000 - 400.000 GRATIS *BASIC FONDI DAY CREAM Nett 10 gr* 2. Setiap pembelian Ecer / Satuan Senilai diatas Rp. 400.000 GRATIS *GOLD MASKER Nett 30 Gr* 3. Setiap Pembelian 1 Paket Wajah atau Badan KOMPLIT GRATIS sepasang (2) Product yaitu *BASIC FONDI DAY CREAM Nett 10 gr* dan *GOLD MASKER Nett 30 Gr* NB: • Berlaku juga pembelian via aplikasi market,. Namun tidak berlaku untuk Promo Diskon Aplikasi Market • Berlaku kelipatan • Tidak ada Subsidi ongkir Note: Promo kami berbeda2 yaah. Jd jika memang di Rasa tertarik,. Silahkan segera Order.. Dan ini adalah Manfaat Produk tsb adalah sbb: *MANFAAT BASIC FONDI DAY CREAM:* 1. Melindungi kulit dari berbagai radiasi 2. Melindungi kulit dari paparan sinar Ultraviolet A dan B 3. Merawat serta memberikan kelengkapan nutrisi pada kulit 4. Membantu mencerahkan kulit 5. Menstimulasi protein kulit yaitu kolagen guna mengurangi terjadinya kerutan pada kulit wajah 6. Membuat kulit tampak lebih bersinar 7. Mengembalikan kekencangan, kekenyalan serta keremajaan kulit 8. Dengan SPF 30 *MANFAAT GOLD MASKER:* 1. Mencerahkan kulit 2. Mengatasi wajah lelah 3. Mengurangi garis halus 4. Mengangkat sel kulit mati 5. Menghapus dan mengurangi flex noda dan jerawat 6. Anti Aging dan mencegah penuaan dini 7.Mengenyalkan, menghaluskan dan Mengencangkan kulit 8. Mengangkat Komedo / Jerawat Terima Kasih Happy Shopping.. 💋💋 . . Order: Wa: 081217175822 Line: cece_key Shopee.co.id/vbeautycareoriginalpusat #promo #hadiah #kejutan #giveaway #distributorskincarebpom #skincarebpom #vbc #vbeautycare #victorybeautycare #kulitputihglowing #recomendedolshop

Share 3 0
keyshop_beautycare. *GRATIS \"KHUSUS HARI INI* 11/12/18 CLOSE 00.00 WIB

1. Setiap pembelia

*GRATIS "KHUSUS HARI INI* 11/12/18 CLOSE 00.00 WIB 1. Setiap pembelian Ecer / Satuan Senilai Rp. 300.000 - 400.000 GRATIS *BASIC FONDI DAY CREAM Nett 10 gr* 2. Setiap pembelian Ecer / Satuan Senilai diatas Rp. 400.000 GRATIS *GOLD MASKER Nett 30 Gr* 3. Setiap Pembelian 1 Paket Wajah atau Badan KOMPLIT GRATIS sepasang (2) Product yaitu *BASIC FONDI DAY CREAM Nett 10 gr* dan *GOLD MASKER Nett 30 Gr* NB: • Berlaku juga pembelian via aplikasi market,. Namun tidak berlaku untuk Promo Diskon Aplikasi Market • Berlaku kelipatan • Tidak ada Subsidi ongkir Note: Promo kami berbeda2 yaah. Jd jika memang di Rasa tertarik,. Silahkan segera Order.. Dan ini adalah Manfaat Produk tsb adalah sbb: *MANFAAT BASIC FONDI DAY CREAM:* 1. Melindungi kulit dari berbagai radiasi 2. Melindungi kulit dari paparan sinar Ultraviolet A dan B 3. Merawat serta memberikan kelengkapan nutrisi pada kulit 4. Membantu mencerahkan kulit 5. Menstimulasi protein kulit yaitu kolagen guna mengurangi terjadinya kerutan pada kulit wajah 6. Membuat kulit tampak lebih bersinar 7. Mengembalikan kekencangan, kekenyalan serta keremajaan kulit 8. Dengan SPF 30 *MANFAAT GOLD MASKER:* 1. Mencerahkan kulit 2. Mengatasi wajah lelah 3. Mengurangi garis halus 4. Mengangkat sel kulit mati 5. Menghapus dan mengurangi flex noda dan jerawat 6. Anti Aging dan mencegah penuaan dini 7.Mengenyalkan, menghaluskan dan Mengencangkan kulit 8. Mengangkat Komedo / Jerawat Terima Kasih Happy Shopping.. 💋💋 . . Order: Wa: 081217175822 Line: cece_key Shopee.co.id/vbeautycareoriginalpusat #promo #hadiah #kejutan #giveaway #distributorskincarebpom #skincarebpom #vbc #vbeautycare #victorybeautycare #kulitputihglowing #recomendedolshop

Share 6 0
keyshop_beautycare. HANYA HARI INI
FLASH TIME for DISKON

Syarat & Ketentuan: 
1. Hnya ber

HANYA HARI INI FLASH TIME for DISKON Syarat & Ketentuan: 1. Hnya berlaku Hari ini saja, 7 desember 2018. 2. Berlaku selama 24 Jam,. Close order jam 00.00 3. Untuk Paket Wajah / Badan diskon 10% (tidak termasuk paket hemat) 3. Untuk Satuan diskon 5% 4. Tidak ada batas minimal order 5. Tidak ada Subsidi / gratis ongkir 6. Hanya berlaku transfer penjual langsung (tidak melalui market place / aplikasi toko) 7. Stok terbatas, siapa cepat dia dapat. 8. Tidak ada nego wktu. (Di luar wktu yg di tentukan) Yups.. segera order aja ya dear... Terima kasih . . Ordernya disini: Wa: 081217175822 Line: cece_key #promo #flashsale #vbeautycare #victorybeautycare #vbc #distributorpusat #pusatskincarebpom #recomendedolshop

Share 115 0
keyshop_beautycare. *GRATIS KHUSUS HARI INI*  3 Desember 2018 CLOSE 00.00 WIB

1. Setiap p

*GRATIS KHUSUS HARI INI* 3 Desember 2018 CLOSE 00.00 WIB 1. Setiap pembelian Ecer / Satuan Senilai Rp. 300.000 - 400.000 dapat 1 Serum Anti Aging Nett 10 ml 2. Setiap pembelian Ecer / Satuan Senilai diatas Rp. 400.000 dapat 1 Vitamin C Cream with Gluthatione 10 gr 3. Setiap Pembelian 1 Paket Wajah / Badan (Bukan Paket Hemat) dapat sepasang (2) Product yaitu Serum Anti Aging Nett 10 ml DAN Vitamin C Cream with Gluthatione 10 gr 4. Berlaku juga pembelian via aplikasi market,. Namun tidak berlaku untuk Promo Diskon Aplikasi Market 5. Berlaku kelipatan 6. Tidak ada Subsidi ongkir 7. Promo berakhir Hari ini,. Jam 00.00 Note: Promo kami berbeda2 yaah. Jd jika memang di Rasa tertarik,. Silahkan segera Order.. Dan ini adalah Manfaat Produk tsb adalah sbb: *SERUM ANTI AGING* Kegunaan: 1.Mengurangi garis-garis halus pada wajah dan mencegah penuaan 2.Menembus kulit, merevitalisasi dan meremajakan. 3.Membantu meningkatkan sirkulasi darah dan mencerahkan wajah. 4.Meningkatkan elastisitas kulit 5.Memperlambat penipisan kolagen dan elastin untuk mencegah kulit kendur 6.Mengurangi Fine Lines dan Keriput. *Vitamin C Cream with Gluthatione* Kegunaan : 1. Sebagai pelembab untuk kulit kering 2. Menyamarkan kerutan, kantung mata dan lingkaran hitam di bawah mata 3. Membatasi pembentukan garis – garis halus wajah 4. Mencegah penuaan dini 5. Mengenyalkan dan melenturkan kulit 6. Menghaluskan kulit 7. Mencerahkan kulit (look brightness) 8. Mencegah luka jerawat dan menutupnya secara rapat 9. Mencegah pengaruh buruk sinar UV matahari pada kulit (SPF 30) 10. Pemakaian jangka panjang (> 6 bln) menunjukkan kulit wajah terlihat lebih muda Terima Kasih Happy Shopping.. 💋💋 . . Konsul Order: Wa: 081217175822 Line: cece_key Shopee.co.id/vbeautycareoriginalpusat (bisa langsung klik link di bio) #promo #giveaway #hadiah #vbeautycare #victorybeautycare #distributorskincarebpom #skincarebpom #recomendedolshopindonesia #recomendedseller

Share 9 0
victory_beautycare. BASIC FACIAL WASH beraroma white lily adalah sabun yang diformulasikan

BASIC FACIAL WASH beraroma white lily adalah sabun yang diformulasikan memakai Vitamin C dan E serta AHA untuk melindungi kulit dan merawat kelembaban kulit sehingga membuat kulit terasa segar dan tampak putih alami. . Kegunaan : Membersihkan kulit dari kotoran, minyak, lemak, bekas make-up dll, membersihkan sampai ke pori-pori, mengandung AHA dengan yang sesuai dengan PH kulit ( PH 5,5 ). Gel sabun wajah yang tidak menyebabkan jerawat pada kulit, non-comedogenic. Berfungsi : efektif untuk mengangkat kotoran-kotoran di kulit & mempersiapkan proses peremajaan , memelihara dan menjaga kelembaban alami kulit, sehingga kulit menjadi halus, bersih dan kenyal. . IDR 80.000 . V Beauty Care... Victory Beautiful Solutions . . Info konsul & order: WA : 0822-5358-7161 #victory #vbc #victorybeautycare #vbeautycare #skincare #skincaremalang #skincarebpom #skincarehalal #skincarerecomended #perawatanwajah #perawatanbadan #bleaching #peelingbadanampuh #serumbulumata #glowing

Share 4 0
keyshop_beautycare. Whitening High Night Cream 10gram
IDR ONLY 175K .
Kegunaan : bleaching

Whitening High Night Cream 10gram IDR ONLY 175K . Kegunaan : bleaching, whitening, remove flek, anti acne, peeling cream, scar cream. Note : Di pakai saat tertentu bukan sebagai treatment jangka panjang (dlm artian sudah pakai 2 pot setelahnya pakai jarang2 saja bs 1-2x dlm seminggu,, selebihnya bisa diselingi serum/crram mlm basic/diamond). Sangat bantu atasi bekas jerawat sulit hilang, kulit tidak merata, kulit kusam, jerawat, flek. Tidak dapat di gunakan oleh wanita hamil dan menyusui . . Belinya disini Distributor pusatnya vbc: Info konsul order: Line: cece_key Wa: 081217175822 Bbm: D1723236 Melayani cust/resel/agen Pembelian ecer/paket/grosir Banyak promo/bonus/berhadiah #real_keyshop #distributorvbc #distributorvbeautycare #vbeautycare #v #victorybeautycare #bestproduk #vbeautycaremalang #bpom #skincarebpom #perawatankulit #perawatanbadan #perawatanwajah #kulitputih #kulitsehat #bebasjerawat #bebaskomedo #obatjerawat #bebasflek #recomended #recomendedolshop #recomendedseller

Share 183 0
keyshop_beautycare. HANYA HARI INI
FLASH TIME for DISKON

Syarat & Ketentuan: 
1. Hnya ber

HANYA HARI INI FLASH TIME for DISKON Syarat & Ketentuan: 1. Hnya berlaku Hari ini saja, 27 november 2018. 2. Berlaku selama 24 Jam,. Close order jam 00.00 3. Untuk Paket Wajah / Badan diskon 10% (tidak termasuk paket hemat) 3. Untuk Satuan diskon 5% 4. Tidak ada batas minimal order 5. Tidak ada Subsidi / gratis ongkir 6. Hanya berlaku transfer penjual langsung (tidak melalui market place / aplikasi toko) 7. Stok terbatas, siapa cepat dia dapat. 8. Tidak ada nego wktu. (Di luar wktu yg di tentukan) Yups.. segera order aja ya dear... Terima kasih . . Ordernya disini: Wa: 081217175822 Line: cece_key #promo #flashsale #vbeautycare #victorybeautycare #vbc #distributorpusat #pusatskincarebpom #recomendedolshop

Share 35 0
keyshop_beautycare. HANYA HARI INI
FLASH TIME for DISKON

Syarat & Ketentuan: 
1. Hnya ber

HANYA HARI INI FLASH TIME for DISKON Syarat & Ketentuan: 1. Hnya berlaku Hari ini saja, 27 november 2018. 2. Berlaku selama 24 Jam,. Close order jam 00.00 3. Untuk Paket Wajah / Badan diskon 10% (tidak termasuk paket hemat) 3. Untuk Satuan diskon 5% 4. Tidak ada batas minimal order 5. Tidak ada Subsidi / gratis ongkir 6. Hanya berlaku transfer penjual langsung (tidak melalui market place / aplikasi toko) 7. Stok terbatas, siapa cepat dia dapat. 8. Tidak ada nego wktu. (Di luar wktu yg di tentukan) Yups.. segera order aja ya dear... Terima kasih . . Ordernya disini: Wa: 081217175822 Line: cece_key #promo #flashsale #vbeautycare #victorybeautycare #vbc #distributorpusat #pusatskincarebpom #recomendedolshop

Share 37 0
keyshop_beautycare. HANYA HARI INI
FLASH TIME for DISKON

Syarat & Ketentuan: 
1. Hnya ber

HANYA HARI INI FLASH TIME for DISKON Syarat & Ketentuan: 1. Hnya berlaku Hari ini saja, 27 november 2018. 2. Berlaku selama 24 Jam,. Close order jam 00.00 3. Untuk Paket Wajah / Badan diskon 10% (tidak termasuk paket hemat) 3. Untuk Satuan diskon 5% 4. Tidak ada batas minimal order 5. Tidak ada Subsidi / gratis ongkir 6. Hanya berlaku transfer penjual langsung (tidak melalui market place / aplikasi toko) 7. Stok terbatas, siapa cepat dia dapat. 8. Tidak ada nego wktu. (Di luar wktu yg di tentukan) Yups.. segera order aja ya dear... Terima kasih . . Ordernya disini: Wa: 081217175822 Line: cece_key #promo #flashsale #vbeautycare #victorybeautycare #vbc #distributorpusat #pusatskincarebpom #recomendedolshop

Share 37 0
keyshop_beautycare. KHUSUS HARI INI 22 NOP 2018
CLOSE 00.00 WIB

Syarat & Ketentuan :
1. S

KHUSUS HARI INI 22 NOP 2018 CLOSE 00.00 WIB Syarat & Ketentuan : 1. Setiap pembelian Ecer / Satuan Senilai Rp. 300.000 - 400.000 dapat 1 Serum Beauty C&E 2. Setiap pembelian Ecer / Satuan Senilai diatas Rp. 400.000 dapat 1 Serum Beauty Pore 3. Setiap Pembelian 1 Paket Wajah / Badan (Bukan Paket Hemat) dapat sepasang (2) Serum yaitu Serum Beauty C&E dan Serum Beauty Pore 4. Berlaku juga pembelian via aplikasi market,. Namun tidak berlaku untuk Promo Diskon Aplikasi Market shopee 5. Berlaku kelipatan 6. Tidak ada Subsidi ongkir Note: Promo kami berbeda2 yaah. Jd jika memang di Rasa tertarik,. Silahkan segera Order.. Dan ini adalah Manfaat Serum tsb adalah sbb: • SERUM BEAUTY C & E Kegunaan : 1.Sebagai Antioksidan kuat yang melindungi kulit terhadap pengaruh negatif factor luar. 2.Merangsang pembentukan kolagen kulit, yang akan menjaga kekenyalan, kelenturan serta kehalusan kulit 3.Mencerahkan kulit. Dengan vitamin C kulit lebih cerah secara alamiah 4.Menyimpan air 5.Membuat kulit tidak kering, dan lembab • SERUM BEAUTY PORE 1. Membantu mengecilkan pori-pori pada kulit wajah. 2. Mengenyalkan kulit 3. Memberi Kesan Efek Glowing 4. Mencerahkan wajah Terima Kasih Happy Shopping.. 💋💋 . . Info order konsul: Wa: 081217175822 Line: cece_key Shopee.co.id/vbeautycareoriginalpusat (langsung klik di bio instagram ini) #promo #bonus #vbeautycare #victorybeautycare #vbc #kulitputih #glowing #bebasjerawat #bebasflek #recomended

Share 4 0
ira_vbc. .
.
Cream Malam Whitening Plus by V Beauty Care
.
.
WA : 081515467250

. . Cream Malam Whitening Plus by V Beauty Care . . WA : 081515467250 (no phone) . . #vbc #vbeautycare #victorybeautycare #whitening #krimmalam #nightcream #pemutihwajah #glowingskin #glowing @dendronfree #hits . FREE ONGKIR 🤗👉Ayo beli di Shopee! https://shopee.co.id/vbeautycare_official/1551920976?version=8c438225e1994d2cdcff913a22a07465 . .

Share 8 0